PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01007.1.p
Common NameEUGRSUZ_E01007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 176aa    MW: 20585.6 Da    PI: 9.7669
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.14.2e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien+ nrqvt+skRrng++KKA+E+SvLC+a+v++iif+ + k++ey++
  Eucgr.E01007.1.p  9 KRIENTNNRQVTYSKRRNGLIKKAKEISVLCNAKVSLIIFGGSKKMHEYCT 59
                      79***********************************************96 PP

2K-box80.24.9e-2771163193
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       y+++ gk+l++ak+e+l+ e++++kke++nLq ++Rhl G+d++sL++keL  L + Le++l  +R++K+e++ ++ ++ ++ e+e++e n +
  Eucgr.E01007.1.p  71 YHRQCGKRLWDAKHENLNGEIDRIKKENDNLQIKLRHLNGQDINSLNHKELIVLDDVLENGLAFVRDQKMEVINTHRRNHKMLEEENKELNYY 163
                       67788999*********************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.754161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-34296IPR002100Transcription factor, MADS-box
CDDcd002651.44E-37280No hitNo description
PRINTSPR004041.8E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.1E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-1782161IPR002487Transcription factor, K-box
PROSITE profilePS5129712.89784171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGRGKIEIKR IENTNNRQVT YSKRRNGLIK KAKEISVLCN AKVSLIIFGG SKKMHEYCTP  60
STKLTDILDE YHRQCGKRLW DAKHENLNGE IDRIKKENDN LQIKLRHLNG QDINSLNHKE  120
LIVLDDVLEN GLAFVRDQKM EVINTHRRNH KMLEEENKEL NYYAQPLQPN LQERI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-16271168Myocyte-specific enhancer factor 2A
3mu6_B2e-16271168Myocyte-specific enhancer factor 2A
3mu6_C2e-16271168Myocyte-specific enhancer factor 2A
3mu6_D2e-16271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01007.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055971.11e-119PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074744e-82MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A059C2Y81e-126A0A059C2Y8_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g01760.t011e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-76MIKC_MADS family protein